DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and Pi16

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_076223.3 Gene:Pi16 / 74116 MGIID:1921366 Length:498 Species:Mus musculus


Alignment Length:206 Identity:48/206 - (23%)
Similarity:76/206 - (36%) Gaps:68/206 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC---RST 117
            |...:.:::|.|:.|..|:       |.|..|.:|.|.:||:..|       ::...||   .:.
Mouse    32 EDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFA-------KAYAQKCVWGHNK 82

  Fly   118 ERFAYAGQNNALFQYSGAETEYTDAEIIKEEIENWFAER-----SNASPEILASFPEELPNKAVT 177
            || ...|:|  ||..:   .|..|..:   .:.||..|.     |.|:.:         ||:...
Mouse    83 ER-GRRGEN--LFAIT---DEGMDVPL---AVGNWHEEHEYYNFSTATCD---------PNQMCG 129

  Fly   178 KFTIAVAEKNTHVGCAAVRFSRDFYNHF-------------VLTCNF-ATSNIVGQPVY---TPG 225
            .:|..|..|...:||.         :||             :|.||: ...|:.|:..|   ||.
Mouse   130 HYTQVVWSKTERIGCG---------SHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPC 185

  Fly   226 EKATTG--CKN 234
            .:...|  |:|
Mouse   186 SQCPLGYSCEN 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 39/173 (23%)
Pi16NP_076223.3 SCP_HrTT-1 35..168 CDD:240186 39/173 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..277
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.