DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and pi15a

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:226 Identity:56/226 - (24%)
Similarity:87/226 - (38%) Gaps:54/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NCPKDVREVKIEPHHKL-ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCE 108
            |.||..|:..|..:..| ||:..|::|     ||:  .|.|..|..|.|.:.|:       ||.|
Zfish    54 NIPKTRRKRYISQNDMLAILDYHNKVR-----GKV--FPPASNMEYMVWDDTLA-------KTAE 104

  Fly   109 SLPDKC------RSTERFAYAGQNNALFQYSGAETEYTD-AEIIK---EEIENW-FAERSNASPE 162
            .....|      |:..||  .|||     .|.....|.. .:::|   :|:::: |....:.:|.
Zfish   105 QWASTCIWEHGPRNLLRF--LGQN-----LSVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPR 162

  Fly   163 ILASFPEELPNKAVTKFTIAVAEKNTHVGCA----------AVRFSRDFYNHFVLTCNFA-TSNI 216
            .    |.:......|.:|..|...:..||||          ...:.|..|    |.||:: ..|.
Zfish   163 C----PLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATY----LVCNYSPKGNW 219

  Fly   217 VGQPVYTPGEKATTGCKNRYGAAYDYPNLCY 247
            :|:..|..|...:. |...||.:.. .|:|:
Zfish   220 IGEAPYKVGVPCSM-CPPSYGGSCS-NNMCF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 42/173 (24%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 41/171 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585785
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6223
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.