DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and pi15b

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:224 Identity:55/224 - (24%)
Similarity:83/224 - (37%) Gaps:54/224 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PKDVREVKIEPHHKL-ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC--E 108
            ||..|:..|.....: ||:..|::|.||       .|.|..|..|.|.:.|:..|.....||  |
Zfish    53 PKSRRKRYISQSDMIAILDYHNKVRANV-------FPPAANMEYMLWDDGLARSAEAWAATCIWE 110

  Fly   109 SLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEIIKEEIENWFAE-RSNASPEILASFPEE-- 170
            ..|...     ..|.|||  |...:|      :...|.:.::.|:.| |....|     :|.:  
Zfish   111 HGPPYL-----LRYLGQN--LSVRTG------NYRSILQLVKPWYDEVRDYMFP-----YPRDCN 157

  Fly   171 --LPNKA----VTKFTIAVAEKNTHVGCAAVRFSRDFYNHFV----------LTCNFA-TSNIVG 218
              .|.:.    .|.:|..|...:..||||.    :..:|..|          |.||:: ..|.:|
Zfish   158 PHCPMRCYGPMCTHYTQMVWASSNRVGCAI----QTCFNMVVWGAVWREATYLVCNYSPKGNWIG 218

  Fly   219 QPVYTPGEKATTGCKNRYGAAYDYPNLCY 247
            :..|..|... :.|...||.:.. .|:|:
Zfish   219 EAPYRVGVPC-SACPPSYGGSCS-NNMCF 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 42/173 (24%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 42/171 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585764
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.