DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and Glipr1l3

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001360960.1 Gene:Glipr1l3 / 544736 MGIID:3620621 Length:236 Species:Mus musculus


Alignment Length:260 Identity:58/260 - (22%)
Similarity:98/260 - (37%) Gaps:80/260 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFTKVLQLI-LLAVVAISSAV------DYCALPTCLDKHVACNNKGNFSENCPKDVREVKIEPH 58
            ||..|.|..: .||:..|::.:      |...:|:.||               ||.:        
Mouse     1 MALKKKLNFLWTLALYLIATRLPKAFGNDLPRVPSILD---------------PKFI-------- 42

  Fly    59 HKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTE----- 118
             ...||:.||||..|.       |.|..|.::.|.::|:.||....:.|:...:.|.|.:     
Mouse    43 -DAFLNIHNELRRKVQ-------PPAADMNQVIWDQKLAKLAKAWTRECKLGHNPCTSKQYGCLL 99

  Fly   119 RFAYAGQNNALFQYSGAETEYTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAV 183
            .:.:.|:|..|.:   .||:..|.      :.||:.|.::      .:|.:...:|....:|..|
Mouse   100 DYDFIGENIYLGE---IETQPEDV------VNNWYNENTD------YNFVDNTCSKICRNYTQLV 149

  Fly   184 AEKNTHVGCAA------VRFSRDFYNHFVLTCNFA-TSNIV-------GQPVYTPGEKATTGCKN 234
            ..|...:|||.      .|:|...:     .||:: |.|.:       |.|....|::.   |:|
Mouse   150 WAKTFKIGCAVSNCPNLTRYSAGLF-----VCNYSPTGNFLDFRPYRKGDPCSMCGQRK---CEN 206

  Fly   235  234
            Mouse   207  206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 38/162 (23%)
Glipr1l3NP_001360960.1 CAP 40..182 CDD:381818 39/177 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.