DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and PI15

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:279 Identity:64/279 - (22%)
Similarity:105/279 - (37%) Gaps:75/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLAVVAISSAVDY---CALPTCL-----DKHVACNNKGNF---------SENCPKDVREVKIEPH 58
            ::|:.|:|||:.:   |...|.:     |.....||..:.         |.:.||..|:..|..:
Human     1 MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQN 65

  Fly    59 HKL-ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC----RSTE 118
            ..: ||:..|::|     ||:  .|.|..|..|.|.|.|:       |:.|:....|    ..:.
Human    66 DMIAILDYHNQVR-----GKV--FPPAANMEYMVWDENLA-------KSAEAWAATCIWDHGPSY 116

  Fly   119 RFAYAGQNNALFQYSGAETEYTDAEIIKEEIENWFAE-RSNASPEILASFPEELPNKA------- 175
            ...:.|||     .|.....|..   |.:.::.|:.| :..|.|     :|::...:.       
Human   117 LLRFLGQN-----LSVRTGRYRS---ILQLVKPWYDEVKDYAFP-----YPQDCNPRCPMRCFGP 168

  Fly   176 -VTKFTIAVAEKNTHVGCA----------AVRFSRDFYNHFVLTCNFA-TSNIVGQPVYTPGEKA 228
             .|.:|..|...:..:|||          ...:.|..|    |.||:| ..|.:|:..|..|...
Human   169 MCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVY----LVCNYAPKGNWIGEAPYKVGVPC 229

  Fly   229 TTGCKNRYGAAYDYPNLCY 247
            :: |...||.:.. .|||:
Human   230 SS-CPPSYGGSCT-DNLCF 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 38/175 (22%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 38/175 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151190
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6223
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.