DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and im:7150988

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_002667823.1 Gene:im:7150988 / 504039 ZFINID:ZDB-GENE-050309-169 Length:150 Species:Danio rerio


Alignment Length:159 Identity:30/159 - (18%)
Similarity:53/159 - (33%) Gaps:59/159 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 DKCRSTERFAYAGQNNALFQYSGAETEYTDAEII-------------KEEIENWFAE-------R 156
            |.||:.:::|    .:.|.:.|...:|..:.|.:             ||.:::|::|       :
Zfish    31 DLCRAAQKWA----EHMLSKKSLGHSETENGENVYYSFSSVKKTPTGKEAVDSWYSEIKDYNFAK 91

  Fly   157 SNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVLTCNFATSNIVGQPV 221
            |...|:             ...||..|.:.:..:|..             |..:..|..:|||  
Zfish    92 SGHQPK-------------TGHFTQVVWKSSKELGVG-------------LATDGNTVFVVGQ-- 128

  Fly   222 YTPGEKATTGCKNRYGAAYDYPNLCYAKE 250
            |.|....|       .|.|...|:...|:
Zfish   129 YKPAGNIT-------NAGYYEQNVLPKKQ 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 19/119 (16%)
im:7150988XP_002667823.1 SCP_GAPR-1_like 5..135 CDD:240182 25/135 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.