DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and CLEC18B

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001011880.2 Gene:CLEC18B / 497190 HGNCID:33849 Length:455 Species:Homo sapiens


Alignment Length:194 Identity:46/194 - (23%)
Similarity:67/194 - (34%) Gaps:51/194 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LQLILLAVVAISSAVDYCALPTCLDKHV----ACNNKGNFSENCPKDVREVKIEPHHKLILNLFN 67
            |..:|||::..:.|..:   |..|.:..    |.|.|.:|                  |:|:|.|
Human    13 LLAVLLALLGTTWAEVW---PPQLQEQAPMAGALNRKESF------------------LLLSLHN 56

  Fly    68 ELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCE-SLPDKCRSTERFAYAGQNNALFQ 131
            .||:.|.       |.|..|.::.|.:.|:.||......|. ..|.......|....|.|..|..
Human    57 RLRSWVQ-------PPAADMRRLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQLLP 114

  Fly   132 YSGAETEYTDAEIIKEEIENWFAE---RSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGC 192
            ...|.        ..|.:..||||   .|:|:.|...       |...|.:|..|...::.:||
Human   115 AGLAS--------FVEVVSLWFAEGQRYSHAAGECAR-------NATCTHYTQLVWATSSQLGC 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 35/137 (26%)
CLEC18BNP_001011880.2 SCP_euk 50..183 CDD:240180 35/136 (26%)
CLECT 310..443 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151039
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.