DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and glipr2l

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001005978.1 Gene:glipr2l / 449805 ZFINID:ZDB-GENE-041010-53 Length:154 Species:Danio rerio


Alignment Length:180 Identity:37/180 - (20%)
Similarity:55/180 - (30%) Gaps:48/180 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FSENCPKDVREVKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKT 106
            |||...|...|.: ..|....|.|.::|.:..:                .:.|.|:...:|. .:
Zfish     9 FSEEALKTHNEYR-RKHQAPPLKLSSKLCSEAS----------------RYAESLASTRILK-HS 55

  Fly   107 CESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEIIKEEIENWFAERSNASPEILASFPEEL 171
            .||....|         |:|.|...|.....:.||         .|:.|.:.      .:|.:..
Zfish    56 VESSRGNC---------GENLAWASYDQTGKDVTD---------RWYNEVNQ------YNFNQPG 96

  Fly   172 PNKAVTKFTIAV--AEKNTHVGCAAVRFSRDFYNHFVLTCNFATSNIVGQ 219
            .:.....||..|  ..|...||.|.....    :.||:...|...||..|
Zfish    97 FSSGTGHFTAVVWKGSKKLGVGKAVASDG----STFVVARYFPAGNITNQ 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 27/153 (18%)
glipr2lNP_001005978.1 SCP_GAPR-1_like 9..139 CDD:240182 34/175 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.