DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and Ag5r2

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster


Alignment Length:255 Identity:89/255 - (34%)
Similarity:145/255 - (56%) Gaps:13/255 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LQLILLAV----VAISSAVDYCALPTCL-DKHVACNNKGNFSENCPKDVREVKIEPHHK-LILNL 65
            ::|.|||:    :|::.|.|||:...|. ..|:||.:...:..:||.|...:.|...:| :.::.
  Fly     1 MKLALLAILIVSLALAQATDYCSSDICNGGSHIACGHSNWWDSSCPGDAELIDINDDYKWVFVHS 65

  Fly    66 FNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALF 130
            .|:.||.:|||.......|.|||.|.|.:||::||.|||:.|..:.|.|.:|:.|.|:|||.|..
  Fly    66 HNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNLAWQ 130

  Fly   131 QYSGAETEYTD-AEIIKEEIENWFAERSNASPEILA-SFPEELPNKAVTKFTIAVAEKNTHVGCA 193
            .|||   :..| ..|:...::.||.|..|::..|:| .:|......|:..||:.::|:||.:|||
  Fly   131 AYSG---DLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAIGHFTVMMSERNTRLGCA 192

  Fly   194 AVRFSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYD 253
            |.|::||.:|..::.||:||:|::|:.:|:..:....||.:  |...::.|||...|.||
  Fly   193 AARYNRDGWNQVLVACNYATTNMIGRQIYSSCDWGAQGCGS--GTNGEFGNLCSTSEWYD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 58/154 (38%)
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 57/151 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440540
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.