DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and CG8483

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster


Alignment Length:256 Identity:63/256 - (24%)
Similarity:96/256 - (37%) Gaps:63/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILLAVVAISSAVDYCALPTCLDKHVACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNV 73
            ::|..::.||..|.:           |||.| ..:.....:.|.:.::.|        |.||..|
  Fly     7 VLLTTIMIISCEVAF-----------ACNGK-IIASGITAEERSIILQEH--------NRLRQIV 51

  Fly    74 AGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQYSGAETE 138
            |.|:..|.|.|..|.::.|.:||:..|......|:...|..|:..||. .|||.|:. :|.|..:
  Fly    52 ATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFT-MGQNLAII-WSTAPLD 114

  Fly   139 YTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTI--AVAEKNTH-----------V 190
            ..|.: ....|::||.|                    |.|::.  |.:.|..|           |
  Fly   115 ADDGD-FPSRIQSWFNE--------------------VQKYSFGDAWSPKTGHYSQLVWGETSLV 158

  Fly   191 GCAAVRFSRDFYNHFVLTCNFAT-SNIVGQPVYTPGEKATTGCKNRYG--AAYDYPNLCYA 248
            ||....:......:.:..||:.. .|:||   |.|.|.....| :.||  .:..|..||.|
  Fly   159 GCGYAEYKDTSKYNKLYVCNYGPGGNVVG---YNPYEVGKPSC-STYGMKPSSRYQGLCAA 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 40/164 (24%)
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 42/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455038
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6223
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.