DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and scpr-C

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster


Alignment Length:256 Identity:244/256 - (95%)
Similarity:252/256 - (98%) Gaps:0/256 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILLAVVAISSAVDYCALPTCLDKHVACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNV 73
            ::|.:::.||.|.||||||||||||:|||||||||||||||||||||||||||||||||||||||
  Fly     7 ILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNV 71

  Fly    74 AGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQYSGAETE 138
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||||||||
  Fly    72 AGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAVFQYSGAETE 136

  Fly   139 YTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYN 203
            |||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   137 YTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYN 201

  Fly   204 HFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYDNEKVIENTQTM 264
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   202 HFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYDNEKVIENTQTM 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 149/151 (99%)
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 149/151 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440535
Domainoid 1 1.000 97 1.000 Domainoid score I13512
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.