DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and crisp1.7

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_989314.1 Gene:crisp1.7 / 394939 XenbaseID:XB-GENE-5779195 Length:244 Species:Xenopus tropicalis


Alignment Length:198 Identity:42/198 - (21%)
Similarity:59/198 - (29%) Gaps:52/198 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQN 126
            |:::.|..|.:..       |.|..|.||||..|..:.|.....||.                  
 Frog    37 IVDIHNAYRRSAN-------PTASNMLKMSWSIEAENNAKNWATTCN------------------ 76

  Fly   127 NALFQYSGAETEYTDAEIIKEEIENWFAERSNAS-PEILASFPEELPN-------KAV----TKF 179
                ||.........|.|...  ||.|.....|| .|::.|...|..|       |||    ..:
 Frog    77 ----QYHSQPAARQIANITCG--ENLFMSSYPASWEEVIQSLHSEYDNFEYGVGAKAVGLVIGHY 135

  Fly   180 TIAVAEKNTHVGCAAVRFSRDFYN-HFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYP 243
            |..:..|:..:||.......|... .:...|.:..:......:..| .|:...|.       |.|
 Frog   136 TQVMWYKSYRIGCYCTECPNDGVRLKYYYVCQYYPAGNYADRINYP-YKSGPSCA-------DCP 192

  Fly   244 NLC 246
            :.|
 Frog   193 DAC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 36/162 (22%)
crisp1.7NP_989314.1 CAP_CRISP 32..171 CDD:349402 36/164 (22%)
Crisp 188..243 CDD:369954 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.