DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and CG34002

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster


Alignment Length:253 Identity:76/253 - (30%)
Similarity:116/253 - (45%) Gaps:20/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TKVLQLILLAVVAISSAVDYCALPTC-LDK---HVACNNKGNFSENCPKDVREVKIEPH-HKLIL 63
            |.:|.|..|.:|.:....:||.|..| .||   |:.|||.|::|..|.||.:.:.:..| .||||
  Fly     9 TGLLLLFGLNLVFLLPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLIL 73

  Fly    64 NLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLP-DKCRSTERFAYAGQNN 127
            |..|..|:.||||::..||.|.||.|:.|..||:.||.:.||.|:..| |.|.|||.|:....:.
  Fly    74 NHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSYHA 138

  Fly   128 ALFQYSGAETEYTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGC 192
            ...::...|..:   .|::.::..|:.:..:.|...|.. ......|.:..|...:...:..:||
  Fly   139 VYNKFKAKEDTF---RIVRSQLNAWYDQYKHVSSSSLID-GLSTAKKEIGHFLRMIVGPSNRLGC 199

  Fly   193 AAVRFSRDFYNHFVLTCNFATSNIVGQPVY----TPGEKATTGCKNRYGAAYDYPNLC 246
            |.....:..:.|..|.|.::.|......:|    .||...|||...:      :.|||
  Fly   200 AIASIEKGGWTHQWLACLYSCSPQKNSLLYEYSGKPGVYCTTGINGK------FQNLC 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 45/152 (30%)
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 45/153 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455059
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.