DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and Glipr1l2

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:187 Identity:42/187 - (22%)
Similarity:72/187 - (38%) Gaps:43/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC----ESLPDKCRSTER-FAY 122
            :||.||||..|       .|..|.:..|:|...||..|....|.|    .:..||...:.. |..
  Rat    57 VNLHNELRGTV-------FPPGVNLRFMTWDVALSRTARAWGKKCVFERNTHLDKVHESHPVFTD 114

  Fly   123 AGQNNALFQYSGAETEYTDAEIIKEEIENWFAERSNASPEILASFPEE--LPNKAVTKFTIAVAE 185
            .|:|    .:.|.|.::|....|:    :|..||.:      .::..:  :.::..:.:...|.:
  Rat   115 IGEN----MWVGPEKDFTATNAIR----SWHEERKS------YNYVNDTCIEDEDCSHYIQLVWD 165

  Fly   186 KNTHVGCA--------AVRFSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKN 234
            .:..||||        |:.::..|      .||:|....:.:..|..|:..:. |.|
  Rat   166 HSYKVGCAVTPCAKVGAITYAALF------ICNYAPGGTLTRRPYQAGQFCSR-CTN 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 37/163 (23%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 38/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344790
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.