DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and Clec18a

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_030099497.1 Gene:Clec18a / 353287 MGIID:2672935 Length:615 Species:Mus musculus


Alignment Length:206 Identity:48/206 - (23%)
Similarity:70/206 - (33%) Gaps:49/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCES--LPDKCRSTERFAYA 123
            |||...|.||:.|.       |.|..|.:|.|.|.|:.||......|.:  .|:...:....::.
Mouse   129 LILTAHNRLRSRVH-------PPAANMQRMDWSESLAQLAEARAALCVTSVTPNLASTPGHNSHV 186

  Fly   124 GQNNALFQYSGAETEYTDAEIIKEEIENWFAE-----RSNASPEILASFPEELPNKAVTKFTIAV 183
            |.|..|.....|.        ..|.:..||||     ..:|         |...|.....:|..|
Mouse   187 GWNVQLMPMGSAS--------FVEVVNLWFAEGLQYRHGDA---------ECAHNATCAHYTQLV 234

  Fly   184 AEKNTHVGCAAVRFSRDFYNHFVLTCNFATS---NIVGQPVYTPGEKAT---------TGCKNRY 236
            ...::.:||.......|........|.::..   :|.|:.| .|.:|.|         :||..  
Mouse   235 WATSSQLGCGRQPCFVDQEAMEAFVCAYSPGGNWDINGKTV-APYKKGTWCSLCTARVSGCFK-- 296

  Fly   237 GAAYDYP-NLC 246
              |:|:. .||
Mouse   297 --AWDHAGGLC 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 36/157 (23%)
Clec18aXP_030099497.1 CAP_euk 129..263 CDD:349399 36/157 (23%)
EGF_Lam 315..360 CDD:214543
CLECT 390..514 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.