DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and CG10651

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:242 Identity:70/242 - (28%)
Similarity:113/242 - (46%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YCALPTCLDKHVACNNKGNFSENCPKDVRE-VKIE-PHHKLILNLFNELRNNVAGGKIEGLPKAV 85
            :|....|..:||.|::.|||...|||.... ||:. ....||::..||.||..||| ::..|||.
  Fly    23 WCKADLCRGQHVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGG-MDQNPKAA 86

  Fly    86 RMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEIIKEEIE 150
            ||..:.|..||:.:|...|:.||.:.|:|..|..:.:|..:.:|.:|....|:   .|.::::::
  Fly    87 RMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSLEKYFCMTTK---KEALRKQLD 148

  Fly   151 NWFAERSNASPEILASF------PEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVL-- 207
            :||  ..|:..|:...|      .:||..    .:...:.::...||||.|.:.|....|.:|  
  Fly   149 HWF--DPNSKDEVQKLFFSWTKNQQELSK----NYFQVLRDRANRVGCAIVEYVRPALVHQLLKC 207

  Fly   208 --TCNFATSNIVGQPVY-TPGEKATTGCKNRYGAAYDYPNLCYAKEI 251
              .|..:.......||| ...|:|.:.|..  |:...|.|||:..|:
  Fly   208 VYNCGVSLCEEEDNPVYEDTDEEAASECMK--GSNKQYKNLCHKDEL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 45/161 (28%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 44/158 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440630
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.