DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and CG31296

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster


Alignment Length:250 Identity:86/250 - (34%)
Similarity:127/250 - (50%) Gaps:13/250 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSAVDYCALPTCLDKHVACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNVAGGKIEGL- 81
            |..||:|.||.|...::||||...||..||.:.|.:.:..:..|:|..|||.||..|.||.:.| 
  Fly    20 SKLVDFCQLPYCGTNNLACNNPSKFSVMCPPNARTLSMSTYRNLLLIAFNEFRNYTASGKQKYLK 84

  Fly    82 PKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEIIK 146
            ..|.||:::|:..||..||.|.|.|| |....|.:::.|.|.|.|.....|.|...:|.|.|::.
  Fly    85 AAAARMSRLSYSMELEDLARLAVITC-STHKFCLNSQEFYYVGTNIGSTHYLGNLNDYEDLELML 148

  Fly   147 EEIENW--FAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVLTC 209
            ..|::|  :|:..|....:.  .|..|....:.|..:.:|::||||||:|:||:....::||..|
  Fly   149 RIIQHWTRYADYVNIKMGVY--MPTTLGKSGIAKALLLMADRNTHVGCSAMRFTVHSVHNFVFLC 211

  Fly   210 NFATSNIVGQPVYTPGEKATTGCKNRYGAAYD--YPNLCYAKEIYDNEKVIENTQ 262
            .|:|...|.:|:|....:....||.     .|  |..||...|.|:|.|.:.|.:
  Fly   212 AFSTDLFVERPIYRMSMRPGAACKR-----LDPTYSALCAVGENYENNKPMLNAR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 54/154 (35%)
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 54/155 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.