DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and CG31286

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:164 Identity:33/164 - (20%)
Similarity:57/164 - (34%) Gaps:74/164 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLQLILLAVVAISSAVDYCALPTCLDKHVACN--NKGNFSENCPKDVREVKIEPHHKLILNLFNE 68
            :..|:::.:||||.          .|::.|.|  |.|                    ::|...|:
  Fly     4 IRSLVIVFLVAISE----------FDRNFAINHDNAG--------------------IVLREINK 38

  Fly    69 LRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNV--KTCESLPDKCRSTERFAYAGQNNALFQ 131
            .|:.      .|:||               |.|.||  |.|:|          :|:....:|...
  Fly    39 RRDR------HGVPK---------------LTLDNVLSKGCQS----------YAWKLSKSATLN 72

  Fly   132 YSG-AETEYTDA----EI----IKEEIENWFAER 156
            ||. ...:||::    |:    :...::||:..|
  Fly    73 YSDPTNKDYTESICRFEVKRGALSRCVKNWYNGR 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 23/108 (21%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 25/131 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455149
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.