DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and Crispld1

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:215 Identity:56/215 - (26%)
Similarity:80/215 - (37%) Gaps:36/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC--ESLPDKCRSTERFAYAG 124
            ||:|.|:||:.|       .|.|..|..|:|..||...|....:||  |..|     |......|
  Rat    65 ILDLHNKLRSQV-------YPAASNMEYMTWDVELERSAESWAETCLWEHGP-----TSLLPSIG 117

  Fly   125 QNNALFQYSGAETEYTDAEIIKEEIENWFAE-RSNASP---EILASFPEELPNKAVTKFTIAVAE 185
            ||  |..:.|.....|      ..::.|:.| |..:.|   |.....|........|.:|..|..
  Rat   118 QN--LGAHWGRYRPPT------FHVQAWYDEVRDFSYPYEHECDPYCPFRCSGPVCTHYTQVVWA 174

  Fly   186 KNTHVGCAA-VRFSRDFYNHF-----VLTCNFA-TSNIVGQPVYTPGEKATTGCKNRYGAAYDYP 243
            .::.:|||. :..:.:.:...     .|.||:: ..|..|...|..| |..:.|...:|... ..
  Rat   175 TSSRIGCAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHG-KPCSACPPSFGGGC-RE 237

  Fly   244 NLCYAKEIYDNEKVIENTQT 263
            |||| ||..|.....:..:|
  Rat   238 NLCY-KEGSDQYYTPQEEET 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 41/161 (25%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 41/161 (25%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344622
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.