DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and Glipr1

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:281 Identity:57/281 - (20%)
Similarity:93/281 - (33%) Gaps:85/281 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVLQLILLAVVAISSAVDYCA--LPTCLDKHVACNNKGNFSENCPKDVREVKIEPHHKLILNLFN 67
            :||..:::.:.:.:|...|.|  ||...::        :|.|.|        :|.|        |
  Rat     2 QVLLAVMVWMASSASGFSYTASTLPKITNE--------DFIEEC--------VEVH--------N 42

  Fly    68 ELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC--ESLPD-KCRSTERFAYAGQN--- 126
            ..|:       :..|.|..|..|||..:|:.:|....::|  :..|. ..|....|...|:|   
  Rat    43 HFRS-------KAYPPAGNMLYMSWDPKLAQIAKAWAQSCVFQHNPQLHSRIHPNFTGLGENIWL 100

  Fly   127 NALFQYSGAETEYTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVG 191
            .:|..:|           ::..|..||.|..      ...|......|....:|..|...:..:|
  Rat   101 GSLSLFS-----------VRAAILAWFEESQ------YYDFSTGKCKKVCGHYTQIVWADSYKIG 148

  Fly   192 CAAVRFSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTG-------CKNRYGAAYDYPNLC--- 246
            ||.....|.  .:|:  ||:..:.  ..|.:...:.||..       |.|         |||   
  Rat   149 CAVQLCPRG--ANFI--CNYGPAG--NYPTWPYKQGATCSACPKDDKCLN---------NLCTNP 198

  Fly   247 ----YAKEIYDNEKVIENTQT 263
                .::...|..|.:.|..|
  Rat   199 QRDQVSRHSADYPKYLRNRYT 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 33/157 (21%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 38/179 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344706
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.