DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and Pi16

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:206 Identity:47/206 - (22%)
Similarity:72/206 - (34%) Gaps:68/206 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC---RST 117
            |...:.::.|.|..|..|:       |.|..|.:|.|.:||:..|       ::...||   .:.
  Rat    36 EDEKQTMVELHNHYRAQVS-------PPASDMLQMRWDDELAAFA-------KAYAQKCVWGHNK 86

  Fly   118 ERFAYAGQNNALFQYSGAETEYTDAEIIKEEIENWFAER-----SNASPEILASFPEELPNKAVT 177
            || ...|:|  ||..:   .|..|..:   .:.||..|.     |.|:.:         |.:...
  Rat    87 ER-GRRGEN--LFAIT---DEGMDVPL---AVGNWHEEHEYYNLSTATCD---------PGQMCG 133

  Fly   178 KFTIAVAEKNTHVGCAAVRFSRDFYNHF-------------VLTCNF-ATSNIVGQPVY---TPG 225
            .:|..|..|...:||.         :||             :|.||: ...|:.|:..|   ||.
  Rat   134 HYTQVVWSKTERIGCG---------SHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPC 189

  Fly   226 EKATTG--CKN 234
            .:...|  |.|
  Rat   190 SQCPLGYSCVN 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 38/173 (22%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 38/173 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.