Sequence 1: | NP_650062.1 | Gene: | scpr-A / 41358 | FlyBaseID: | FBgn0037889 | Length: | 264 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001186088.1 | Gene: | PI16 / 221476 | HGNCID: | 21245 | Length: | 463 | Species: | Homo sapiens |
Alignment Length: | 232 | Identity: | 58/232 - (25%) |
---|---|---|---|
Similarity: | 83/232 - (35%) | Gaps: | 69/232 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 KLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAG 124
Fly 125 QNNALFQYSGAETEYTDAEIIKEEIENWFAERS--NASPEILASFPEELPNKAVTKFTIAVAEKN 187
Fly 188 THVGCAAVRFSRDFYNHF-------------VLTCNF-ATSNIVGQPVY---TPGEKATTG--CK 233
Fly 234 NR----YGAAYDYPNLCY---------AKEIYDNEKV 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scpr-A | NP_650062.1 | SCP_euk | 60..212 | CDD:240180 | 41/167 (25%) |
PI16 | NP_001186088.1 | SCP_HrTT-1 | 33..166 | CDD:240186 | 41/166 (25%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 262..281 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 303..341 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 383..408 | ||||
O-glycosylated at one site | 386..395 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10334 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.920 |