DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and scl-27

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_503189.2 Gene:scl-27 / 191204 WormBaseID:WBGene00022638 Length:200 Species:Caenorhabditis elegans


Alignment Length:195 Identity:53/195 - (27%)
Similarity:84/195 - (43%) Gaps:32/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ILNLFNELRNNVAGGKIEG---LPKAVRMAKMSWCEELSHLALLNVK-TCESLPDKCRSTERFAY 122
            |:.:.|||.|:||.||.:.   .|||.:|..|.|.:.|:. |:.||| :|:.|  |.|..::|..
 Worm    27 IVKVHNELGNDVACGKYQNHSDYPKASQMMMMKWNQSLAE-AVGNVKHSCQQL--KERYLKKFIK 88

  Fly   123 AGQNNALFQYSGAETEYTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKN 187
            ......::.|:      |..:.::|..|  ...||..:....|:|       .|.:|...:.:|.
 Worm    89 GENLYRVYFYN------TVVDGLQERDE--ILRRSEKAVSTGANF-------EVERFHKILHDKV 138

  Fly   188 THVGCAAVRFSRD-FYNHFVLTCNFATSNIVGQPVYTPGEKAT-----TGCKNRYGAAYDYPNLC 246
            |.:||:......| .|:.....|.:  |.|....:|..||..:     |.|..  .|..::.|||
 Worm   139 TSIGCSYKNCENDQGYDMRYFICKY--SPIDNGDMYHVGEPCSQCPVGTSCNQ--NANSEFFNLC 199

  Fly   247  246
             Worm   200  199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 42/154 (27%)
scl-27NP_503189.2 CAP_euk 27..164 CDD:349399 42/156 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.