DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and scl-17

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_493975.1 Gene:scl-17 / 190174 WormBaseID:WBGene00021780 Length:246 Species:Caenorhabditis elegans


Alignment Length:230 Identity:46/230 - (20%)
Similarity:80/230 - (34%) Gaps:66/230 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LNLFNELRNNVAGGK--IEGL--PKAVRMAKMSWCEELSHLALLNVKTC--------ESLPDKCR 115
            |:..||.|:::|.|.  .:||  ..|..:.||.|...::..|..:...|        |.:..:| 
 Worm    28 LDAHNEFRSSIAKGTYVTKGLLHAPATNIMKMKWNVTIATAAQNHANKCPKGHDGPLEGVSGEC- 91

  Fly   116 STERFAYAGQNNAL--FQYSGA------ETEYTDAEIIKEEIENWFAERSNASPEILASFPEELP 172
                 .::|..||.  ..:.||      .:|||.        :.|       ..::::   :|..
 Worm    92 -----MWSGHINASKGVNHLGAVAAKAWSSEYTK--------KGW-------ETDVMS---DEFF 133

  Fly   173 NKAVTKFTIAVAEKNTHVGCAAVRFSRD-FYNHFVLTCNF---ATSNIVGQPVYTPG-------- 225
            |..|....|.......:|||......:: .|...::.|.:   ...|  |:.:|..|        
 Worm   134 NSGVGHAIIMTWYSQVNVGCGVKLCQKEGDYQLAIVVCKYWGEGQGN--GKIMYESGPTCSACPP 196

  Fly   226 ----EKATTGCKNRY----GAAYDYPNLCYAKEIY 252
                ::||..|.::.    ...|.|..|..:|..|
 Worm   197 NTTCDQATGLCDSKIPDIPEPIYKYDELVNSKPAY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 34/172 (20%)
scl-17NP_493975.1 CAP_euk 25..174 CDD:349399 34/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.