DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and F58E2.5

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_500349.1 Gene:F58E2.5 / 186521 WormBaseID:WBGene00019049 Length:232 Species:Caenorhabditis elegans


Alignment Length:137 Identity:35/137 - (25%)
Similarity:55/137 - (40%) Gaps:35/137 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HKLILNLFNELRNNVAGG----KIE------GLPKAVRMAKMSWCEELSHLALLNVKTCESLPD- 112
            ||.|||.:|.||:.:|.|    |::      .|..|..|.|:.|...|:.||...|.:|.|..| 
 Worm    40 HKDILNAYNNLRSEIANGTFTMKLQFPDITIPLAPAAGMLKLKWNCRLAALAQAYVDSCPSYQDL 104

  Fly   113 -----KCRSTERFAYAG-----QNNALFQYSGAETEYTDAEIIKEEIENWFAER----------S 157
                 |...|..|..|.     ::..|:::...|.::....|    .::||.:.          :
 Worm   105 RVHKPKFPVTYSFLDANLQEHIKDPVLYRFKILEMDFRRGYI----NDDWFKKLISSKSIGCAFN 165

  Fly   158 NASPEIL 164
            |.|..:|
 Worm   166 NCSENVL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 34/136 (25%)
F58E2.5NP_500349.1 CAP_euk 40..177 CDD:349399 35/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.