DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and F57B7.2

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001367203.1 Gene:F57B7.2 / 186438 WormBaseID:WBGene00010192 Length:330 Species:Caenorhabditis elegans


Alignment Length:224 Identity:43/224 - (19%)
Similarity:66/224 - (29%) Gaps:78/224 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LDKHV----------------ACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNVAGGKI 78
            ||||:                ...::.||..:|                |:..||.|.....   
 Worm   126 LDKHMMQTITDVKYMIKHSKYTALSEVNFQRSC----------------LDAHNECRQRYGN--- 171

  Fly    79 EGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAY-----AGQNNALFQYSGAETE 138
                     ..:.|..||:.:|       .:...|.....|..|     .|:|..|.:.:.....
 Worm   172 ---------ENLCWSTELAEMA-------HAWAVKLADRGRVLYPELPGIGENLILKEANEQSHL 220

  Fly   139 YTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYN 203
            .|..|:|:|    |..|..      ...|.:...|....:|:..|.:..|.:|  |.|:.....|
 Worm   221 PTGQEVIQE----WEKEAQ------FFDFDKPRWNPKCQRFSQVVWKDTTELG--AARYWNTANN 273

  Fly   204 HFVLTCNF---ATSNIVGQPVYTPGEKAT 229
            ...:.|.:   ..||       .|||.|:
 Worm   274 CVAVVCFYRPAGNSN-------APGEFAS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 30/159 (19%)
F57B7.2NP_001367203.1 CAP_GAPR1-like 153..286 CDD:349401 33/179 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.