DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and scl-26

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_504963.1 Gene:scl-26 / 183662 WormBaseID:WBGene00016821 Length:208 Species:Caenorhabditis elegans


Alignment Length:229 Identity:50/229 - (21%)
Similarity:84/229 - (36%) Gaps:55/229 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GNFSENCPKDVREVKIEPHHKLILNLFNELRNNVAGG--KIEGLPKAVRMAKMSWCEELSHLALL 102
            |:|:..  .:..|..||.    ::.:.|:|||:.:.|  ....:.|:..|.|:.|...|...|..
 Worm    14 GSFAST--HEWNETAIEG----LVFVHNKLRNDASQGLWARHNISKSTDMQKLFWNNSLVAEAKH 72

  Fly   103 NVKTCESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAE------IIKEEIENWFAERSNASP 161
            .:..|:.|      .:|....|:|  ::||.  .|.|.|.:      .|.::..:..:.:..|:.
 Worm    73 EMYDCDQL------EKRELTLGEN--IYQYD--VTTYDDVDGQQGEAAINKDSHDALSSKDQAAQ 127

  Fly   162 ----EILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSR-----DFYNHFVLTCNF--ATSN 215
                :||.|                   |:..:||......|     ..||...:.|.:  |..|
 Worm   128 YRLRQILYS-------------------KSNSIGCIYESCDRIDDEGTNYNTRFIICKYSPALKN 173

  Fly   216 IVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAK 249
            |..| :|..||:|.:.|.:..........||..|
 Worm   174 IDDQ-LYEEGEEACSNCPSGTSCTDPMMKLCEKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 33/170 (19%)
scl-26NP_504963.1 CAP_euk 30..168 CDD:349399 33/166 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.