DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and scl-23

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_499859.3 Gene:scl-23 / 182028 WormBaseID:WBGene00015246 Length:330 Species:Caenorhabditis elegans


Alignment Length:225 Identity:54/225 - (24%)
Similarity:81/225 - (36%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LILNLFNELRNNVAGGKI----EGLPKAVRMAKMSWCEELSHLALLNVKTCESLP---------- 111
            |||:..||:|:.||.|:.    :.||.|..|.|:.|..||...|....:.|....          
 Worm   124 LILDKHNEIRSQVALGQYAVDDDYLPPADNMVKLDWDCELELEAQQRAQQCNLQKENSGRQMNGW 188

  Fly   112 DKCRSTERFAYAGQNNALFQYSGA---ETEYTDAEIIKEEIENW----FAERSNASPEILASFPE 169
            |:.|....|.:...:.  ...|||   ..:....||....|:|.    :..|...:.:||.    
 Worm   189 DEVRGENAFYFRTTDG--LDVSGAVLKGIQRMGDEIAIAGIKNLKLSRYDSRIGHATQILW---- 247

  Fly   170 ELPNKAVTKFTIAVAEKNTHVGCAAVR-FSRDFYNHFVLTCN-FATSNI----VGQPVYTPGEKA 228
                |...|...||.|      |.|.: .|.|...:.|..|. :.|.|:    ....:|:.|:.|
 Worm   248 ----KETRKLGCAVQE------CPARQDGSLDGQKYNVAVCKYYPTGNVFKSSTPTSIYSVGDVA 302

  Fly   229 TTGCKNRYGAAYDYPN--LCYAKEIYDNEK 256
            :...:..:|.    |:  ||.|....:..|
 Worm   303 SACSEGTFGD----PSTGLCVAATWQEGSK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 43/173 (25%)
scl-23NP_499859.3 CAP_euk 122..281 CDD:349399 43/172 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157346
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.