DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and vap-1

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001024553.1 Gene:vap-1 / 181768 WormBaseID:WBGene00006886 Length:424 Species:Caenorhabditis elegans


Alignment Length:264 Identity:59/264 - (22%)
Similarity:95/264 - (35%) Gaps:81/264 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LAVVAISSAVDYCALPTCLDKHVA----CNNKGNFSENCPKDVREVKI-EPHHKLILNLFNELRN 71
            :||:|:      ..|..||::.||    |:|              .|| :...|:..:..|:.|.
 Worm     1 MAVLAV------VLLLACLERAVAQTFGCSN--------------TKINDQARKMFYDAHNDARR 45

  Fly    72 NVAGG----KIEGLPKAVRMAKMSW-CEELSHLALLNVKTCESLPDKCRST-ERFAYA-GQNNAL 129
            ::|.|    |...|.....:.:::| ||       :..| .:...|.|.|: :.|... |||.|.
 Worm    46 SMAKGLEPNKCGLLSGGKNVYELNWDCE-------MEAK-AQEWADGCPSSFQTFDPTWGQNYAT 102

  Fly   130 FQYSGAE-TEYTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCA 193
            :..|.|: ..|...     .:..|::|.....   |.....:..|.|:.:|......|.:..|||
 Worm   103 YMGSIADPLPYASM-----AVNGWWSEIRTVG---LTDPDNKYTNSAMFRFANMANGKASAFGCA 159

  Fly   194 ----AVRFSRD-FYNHFVLTCNFATSNIVGQPVYTPGEKATTG----------CKNRYGAAYDYP 243
                |.:.|.: .||..    .:.|:.|    :|..|:..|:.          |||         
 Worm   160 YALCAGKLSINCIYNKI----GYMTNAI----IYEKGDACTSDAECTTYSDSQCKN--------- 207

  Fly   244 NLCY 247
            .|||
 Worm   208 GLCY 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 36/164 (22%)
vap-1NP_001024553.1 SCP 31..175 CDD:214553 35/159 (22%)
SCP 234..386 CDD:214553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.