DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and CRISP1

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:257 Identity:59/257 - (22%)
Similarity:98/257 - (38%) Gaps:58/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLAVVAISSAVDYCALPTCLDKHVACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNVAG 75
            ||.:||.:     |.||....|..:..::.|   ....|:..|:.|     |:|:.|.||..|  
Human     6 LLFLVAAA-----CLLPMLSMKKKSARDQFN---KLVTDLPNVQEE-----IVNIHNALRRRV-- 55

  Fly    76 GKIEGLPKAVRMAKMSWCEELSHLALLNVKTC---ESLPDKCRSTERFAYAGQNNALFQYSGAET 137
                 :|.|..|.||||.||.:..|.:..|.|   ||.|.:.|....|  .|:|..:..|..:.:
Human    56 -----VPPASNMLKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTF--CGENMHMTSYPVSWS 113

  Fly   138 EYTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFY 202
            ..         |..|::|.::.......:..:::.....|:...|.:..   :|||.....:...
Human   114 SV---------IGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYL---IGCAIASCRQQGS 166

  Fly   203 NHFVLTCNFA-------TSNIVGQPVYT--PGEKATTGCKNRYGAAYDYPNLCYAKEIYDNE 255
            ..::..|::.       |.|   :|..|  |.|...:.|:::         ||....||.:|
Human   167 PRYLYVCHYCHEGNDPETKN---EPYKTGVPCEACPSNCEDK---------LCTNPCIYYDE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 35/154 (23%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 37/163 (23%)
Crisp 195..249 CDD:285731 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151253
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.