DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and CG43777

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:282 Identity:82/282 - (29%)
Similarity:132/282 - (46%) Gaps:55/282 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLAVV---AISSAVDYCALPT--CL---DKHVACNNK-----GN---FSENCPKDVREVKIEPH 58
            :|||||   .::|..:||...|  |:   .||..|:.|     ||   |..:.|.::|      .
  Fly     5 LLLAVVLLLPLTSGYNYCNNKTHKCVLEKKKHFMCHLKDFTVYGNSTKFHASVPNNMR------M 63

  Fly    59 HKLILNLFNELRNNVAGGKI-----EGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTE 118
            .|:.|::.|.|||..|||::     :...||.||.::.|.:||:::...:..|......:||||.
  Fly    64 QKIALDILNNLRNKFAGGELRTKGNKTFAKARRMRQLFWDKELAYMGNNHASTLSLKSSQCRSTL 128

  Fly   119 RFAYAGQNNALFQYSGAETEYTDAEIIKEEIENWFAERSNAS-PE-ILASFPEELPNK--AVTKF 179
            ||.:.|:..||..   ...:....||..:.....|||..:.| |: :|.:|.   |::  .|..|
  Fly   129 RFPHVGEAIALVT---PREKLNLKEIYSKAFTPMFAEYQHVSDPDALLHAFD---PDRDFQVRHF 187

  Fly   180 TIAVAEKNTHVGCA---------AVRFSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKNR 235
            |..::::.:.|||.         :::|.     || |||.|...|:.|..||..|: .|:.|.:.
  Fly   188 TNIISDRVSRVGCGVAVGANCNPSIKFC-----HF-LTCYFDFHNMAGSYVYKAGD-PTSSCDDW 245

  Fly   236 YGAAYD-YPNLC-YAKEIYDNE 255
            ...:.| |.||| .:.||:.::
  Fly   246 GVVSSDKYANLCKNSGEIFPHD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 48/169 (28%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 48/170 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440628
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.