DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and Crisp3

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_033769.1 Gene:Crisp3 / 11572 MGIID:102552 Length:241 Species:Mus musculus


Alignment Length:217 Identity:41/217 - (18%)
Similarity:71/217 - (32%) Gaps:61/217 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LQLILLAVVAISSAVDYCALPTCLDKHVACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRN 71
            |.|:|..:.|:        ||..|   :..|::.|..|......:.|:.|     |::..|:||.
Mouse     3 LMLVLFFLAAV--------LPPSL---LQDNSQENSLEKLSTSKKSVQEE-----IVSKHNQLRR 51

  Fly    72 NVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQYSGAE 136
            .|:       |....:..|.|    ::.|.:|   .:...|||              .|.:|..|
Mouse    52 KVS-------PSGSDLLNMEW----NYDAQVN---AQQRADKC--------------TFSHSPIE 88

  Fly   137 TEYTDAEI------------IKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTH 189
            ...|:.:.            ....|:.|:    |.|..::.....:.....|...|..|.:.|..
Mouse    89 LRTTNLKCGENLFMSSYLVPWSSVIQGWY----NESKGLIFGVGPKQNVSVVGHHTQVVWKSNLQ 149

  Fly   190 VGCAAVRFSRDFYNHFVLTCNF 211
            |.|.......:...:|.: |.:
Mouse   150 VACGVAECPENPLRYFYV-CRY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 29/164 (18%)
Crisp3NP_033769.1 SCP 37..172 CDD:294090 31/172 (18%)
Crisp 194..241 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841438
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.