DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and Crisp1

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_033768.3 Gene:Crisp1 / 11571 MGIID:102553 Length:244 Species:Mus musculus


Alignment Length:270 Identity:56/270 - (20%)
Similarity:99/270 - (36%) Gaps:68/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LQLILLAVVAISSAVDYCALPTCLDKHVACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRN 71
            |.|:|..:.|:        ||..|.:..:..|:..........|:|..:..|        |:||.
Mouse     3 LMLVLFFLAAV--------LPPSLLQDSSQENRLEKLSTTKMSVQEEIVSKH--------NQLRR 51

  Fly    72 NVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC---------RSTERFAYAGQNN 127
            .|:       |....:.||.|    ::.|.:|   .:...|||         |:|.  ...|:|.
Mouse    52 MVS-------PSGSDLLKMEW----NYDAQVN---AQQWADKCTFSHSPIELRTTN--LRCGENL 100

  Fly   128 ALFQYSGAETEYTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGC 192
            .:..|..:   ::.|      |:.|:.|..:.:.::   .|:: |:..|..:|..|......|.|
Mouse   101 FMSSYLAS---WSSA------IQGWYNEYKDLTYDV---GPKQ-PDSVVGHYTQVVWNSTFQVAC 152

  Fly   193 AAVRFSRDFYNHFVLTCNFA-TSNIVGQPVYTP---GEKATTG--------CKNRYGAAYDYPNL 245
            ......::...::.: |::. ..|..|: :|||   ||...:.        |.|..|....|.|.
Mouse   153 GVAECPKNPLRYYYV-CHYCPVGNYQGR-LYTPYTAGEPCASCPDHCEDGLCTNSCGHEDKYTNC 215

  Fly   246 CYAKEIYDNE 255
            .|.|::...|
Mouse   216 KYLKKMLSCE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 30/160 (19%)
Crisp1NP_033768.3 SCP_CRISP 37..172 CDD:240183 33/172 (19%)
Crisp 190..244 CDD:285731 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841437
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.