DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and LOC101732829

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_017949574.2 Gene:LOC101732829 / 101732829 -ID:- Length:290 Species:Xenopus tropicalis


Alignment Length:262 Identity:56/262 - (21%)
Similarity:98/262 - (37%) Gaps:64/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLQLILLAVVAISSAVDYCALPTCLDKHVACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELR 70
            ::.|::|.::..|   .|.|:|..:                |.:.:......:.::|:::.|..|
 Frog    48 MMPLVVLCILFFS---QYGAVPIIV----------------PYETQSTDNATNRQIIVDVHNRWR 93

  Fly    71 NNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESL--PDKCRSTERFAYAGQNNALFQYS 133
            .||.       |.|:.|.||.|.:|.:..|.:..:||...  |...|:...|: .|||..:..||
 Frog    94 GNVT-------PTAMNMLKMEWNDEAAKKAEIWARTCNQFHNPASQRNITNFS-CGQNLFMASYS 150

  Fly   134 GAETEYTDAEIIKEEIENWFAERSN----ASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAA 194
               |.:..|      :..||.|..:    ..|:...:.        :..:|......:..|||..
 Frog   151 ---TTWEAA------VTAWFDEIKDFDFGKGPKTFGAL--------IGHYTQGAWYNSRMVGCYE 198

  Fly   195 VRFSRDFYNHFVLTCNFA-TSNIVGQPVYTPGEKATT------GCKNRYGAAYDYPNLCYAKEIY 252
            .......|.::.: |::. ..||.|:. :||.:...|      .|:|  |...:|   |.....|
 Frog   199 FECPNAEYRYYYV-CHYCPAGNIEGKQ-FTPYKIGPTCGDCPKSCEN--GVCTNY---CPHPINY 256

  Fly   253 DN 254
            ||
 Frog   257 DN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 35/157 (22%)
LOC101732829XP_017949574.2 CAP 80..217 CDD:412178 35/162 (22%)
Crisp 234..289 CDD:400739 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.