DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and r3hdml

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_017953344.1 Gene:r3hdml / 100492715 XenbaseID:XB-GENE-1011048 Length:253 Species:Xenopus tropicalis


Alignment Length:233 Identity:56/233 - (24%)
Similarity:88/233 - (37%) Gaps:60/233 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FSENCPKDVREVKIEPHH-KLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVK 105
            |....|:..|:..|.|.. ..:|:..|::|:.|       .|.|..|..|.|.|.|:       |
 Frog    45 FGSGIPRIRRKRYISPRDMSALLDYHNQVRSKV-------FPPAANMEYMVWDERLA-------K 95

  Fly   106 TCESLPDKCR----STERFAYAGQNNALFQYSGAETEYTDAEIIKEEIENWFAERSNASPEILAS 166
            :.||..::|:    ..:...|.|||  |..:||......|.      ::.|:.||.:      .|
 Frog    96 SAESWANQCKWDHGPNQLMRYIGQN--LSVHSGRYRSIVDL------VKGWYDERQH------YS 146

  Fly   167 FPE------ELPNKAV----TKFTIAVAEKNTHVGCA----------AVRFSRDFYNHFVLTCNF 211
            ||.      ..|||..    |.:|..|...:..:|||          ...:.:..|    |.||:
 Frog   147 FPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASY----LVCNY 207

  Fly   212 A-TSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYA 248
            : ..|.:|:..|..| :..:.|...||.... .|:|::
 Frog   208 SIKGNWIGEAPYKLG-RPCSACPPSYGGVCS-NNMCFS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 42/175 (24%)
r3hdmlXP_017953344.1 CAP_R3HDML 63..208 CDD:349409 42/176 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.160

Return to query results.
Submit another query.