DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and crisp1.11

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_031758901.1 Gene:crisp1.11 / 100492430 XenbaseID:XB-GENE-22169829 Length:266 Species:Xenopus tropicalis


Alignment Length:261 Identity:60/261 - (22%)
Similarity:98/261 - (37%) Gaps:67/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLAVVAISSAVDYCALPTCLDKHVACNNKGNFS----ENCPKDVREVKIEPHHKLILNLFNELR 70
            :|:..:.|::.|:          |...:....||    :|  ..||::.|:.|        |..|
 Frog    27 LLIGALCIAAFVN----------HAVASADPPFSSISTDN--STVRQIIIDTH--------NAYR 71

  Fly    71 NNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC---ESLPDKCRSTERFAYAGQNNALFQY 132
            .|.:       |.|..|.||.|.|:.::.|......|   .|.||| |:...|: .|:|..|..|
 Frog    72 RNAS-------PSARNMLKMVWNEDAANNAASWSAGCTGSHSPPDK-RTIPGFS-CGENLFLASY 127

  Fly   133 SGAETEYTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRF 197
            ..:         .:|.::.||.|  |.|.|.  ....:.|::.|..:|..:...:..|||:....
 Frog   128 PAS---------WEEAVKAWFDE--NESFEY--GVGPKSPDQVVGHYTQVMWYNSYMVGCSVSYC 179

  Fly   198 SRDFYNHFVLTCNFA-TSNIVG--QPVYTPGEK------------ATTGC--KNRYGAAYDYPNL 245
            .:..|.:|.: |.:. ..||.|  ...|..|.|            .|..|  ::.|.:..:|.:.
 Frog   180 PKSQYKYFYV-CQYCPAGNIEGVMNTPYKAGPKCADCVEACDNSLCTNYCPYQDTYSSCSNYTSY 243

  Fly   246 C 246
            |
 Frog   244 C 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 38/154 (25%)
crisp1.11XP_031758901.1 CAP_CRISP 58..195 CDD:349402 42/167 (25%)
Crisp 212..263 CDD:400739 5/33 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.