DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and crispld1

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_002937123.2 Gene:crispld1 / 100490431 XenbaseID:XB-GENE-989389 Length:514 Species:Xenopus tropicalis


Alignment Length:214 Identity:55/214 - (25%)
Similarity:74/214 - (34%) Gaps:53/214 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC--ESLPDKCRSTE 118
            |...||||:|.|:||..|       .|.|..|..|.|..||...|....:||  |..|     .:
 Frog    59 ESDMKLILDLHNKLRGEV-------YPPASNMEFMIWDVELERSAEAWAETCLWEHGP-----AD 111

  Fly   119 RFAYAGQNNALFQYSGAETEYTDAEIIKEEIENWFAE-RSNASPEILASFPEE--------LPNK 174
            .....|||  |..:.|.....|      ..::.|:.| |....|     :|:|        ....
 Frog   112 LLPVIGQN--LGAHWGRYRPPT------YHVQAWYDEVRDYTFP-----YPQECDPYCPFRCSGP 163

  Fly   175 AVTKFTIAVAEKNTHVGCA----------AVRFSRDFYNHFVLTCNFA-TSNIVGQPVYTPGEKA 228
            ..|.:|..|...::.:|||          ...:.:..|    |.||:: ..|..|...|..|...
 Frog   164 VCTHYTQLVWATSSRIGCAINLCHNMNVWGQIWPKAIY----LVCNYSPKGNWWGHAPYKHGHPC 224

  Fly   229 TTGCKNRYGAAYDYPNLCY 247
             :.|...||.... .||||
 Frog   225 -SACPPSYGGGCK-DNLCY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 43/172 (25%)
crispld1XP_002937123.2 CAP_CRISPLD1 62..207 CDD:349407 43/173 (25%)
LCCL 304..388 CDD:128866
LCCL 407..506 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6223
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.