DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and glipr2

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001107504.1 Gene:glipr2 / 100135358 XenbaseID:XB-GENE-5758336 Length:441 Species:Xenopus tropicalis


Alignment Length:258 Identity:54/258 - (20%)
Similarity:78/258 - (30%) Gaps:78/258 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VAISSAVDYCALPTCLDKHVAC---NNKGNFSEN-CPK--------------------------- 48
            |.::.|||...:...:.::...   .|.|.|.:| .||                           
 Frog    45 VGVAKAVDGKGMVIAVAQYSPAGNITNPGYFQKNVLPKGTPVSNTGTSPTARGTSYLGTRGTDSA 109

  Fly    49 -----DVREVKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCE 108
                 |.||..:|     .|...|..|:. .|.|...|...:......|.|.     |||:|..:
 Frog   110 LSPTADSREFALE-----FLKANNVYRSR-HGAKPLQLNSKISQEAQRWAEH-----LLNLKNLK 163

  Fly   109 SLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEIIKEEIENWFAERSNASPEILASFPEELPN 173
            . .|.......:|.:|         |.....|..|:    .::|:.|..|.:    .|.|   .|
 Frog   164 H-SDTSHGENIWAKSG---------GPSITVTGQEV----ADSWYKEEKNYN----FSKP---GN 207

  Fly   174 KAVT-KFTIAVAEKNTHVGCAAVRFSRDF------YNHFVLTCNFATSNIVGQPVYTPGEKAT 229
            ||.| .||..|.:.:..||.......:..      ||.   :.|.......|:.|...|.|.|
 Frog   208 KAKTGHFTQMVWKASKEVGVGLASSGKGMLIVVAQYNP---SGNITNPGFYGRNVLPRGSKVT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 35/158 (22%)
glipr2NP_001107504.1 SCP <3..69 CDD:294090 4/23 (17%)
SCP_GAPR-1_like 118..249 CDD:240182 36/165 (22%)
SCP_GAPR-1_like 295..426 CDD:240182
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.