DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-A and R3hdml

DIOPT Version :9

Sequence 1:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001092801.1 Gene:R3hdml / 100043899 MGIID:3650937 Length:253 Species:Mus musculus


Alignment Length:218 Identity:46/218 - (21%)
Similarity:80/218 - (36%) Gaps:50/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PHHK-----------LILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESL 110
            |.|:           .:|:..|.:|.:|.       |.|..|..|.|.|:|:       ::.|:.
Mouse    50 PRHRRKRHISARDMSALLDYHNHIRASVH-------PPAANMEYMVWDEQLA-------RSAEAW 100

  Fly   111 PDKCRST----ERFAYAGQNNALFQYSGAETEYTDAEIIKEEIENWFAERSN----ASPEILASF 167
            ..:|..|    :...|.|||.::  :||......|.      :.:|..|:.:    |..:.....
Mouse   101 ATQCIWTHGPSQLMKYVGQNLSI--HSGRFRSVVDL------VRSWSEEKRHYSFPAPKDCTPHC 157

  Fly   168 PEELPNKAVTKFTIAVAEKNTHVGCAAVRFS------RDFYNHFVLTCNFA-TSNIVGQPVYTPG 225
            |........:.:|..|...::.:|||....|      ..:.....|.||:| ..|.:|:..|..|
Mouse   158 PWLCSGPVCSHYTQMVWASSSRLGCAINTCSSINVWGNTWQQAVYLVCNYAIKGNWIGEAPYKAG 222

  Fly   226 EKATTGCKNRYGAAYDYPNLCYA 248
             |..:.|...|....: .|:|::
Mouse   223 -KPCSACPPSYQGNCN-SNMCFS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 34/176 (19%)
R3hdmlNP_001092801.1 CAP_R3HDML 63..208 CDD:349409 34/166 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841246
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.