DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and PRY3

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:33/165 - (20%)
Similarity:60/165 - (36%) Gaps:47/165 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDK--CRS--TERFAY 120
            :||..|:.|           ...|..|.::|.:.|:..|       ::..|:  |..  |.....
Yeast    29 VLNEHNKFR-----------ALHVDTAPLTWSDTLATYA-------QNYADQYDCSGVLTHSDGP 75

  Fly   121 AGQNNALFQYSGAETEYTDAEIIKEQIENWFAERSN---ASPEILASFPEELPNKAVTKFTIAVA 182
            .|:|.||        .|||.    ..::.|:.|.|.   ::|    .|.|     :...||..|.
Yeast    76 YGENLAL--------GYTDT----GAVDAWYGEISKYNYSNP----GFSE-----STGHFTQVVW 119

  Fly   183 EKNTHVGCAAVRFSRDFYNHFVLTCNFATSNIVGQ 217
            :....:|| ..::....:|::::.......|.:|:
Yeast   120 KSTAEIGC-GYKYCGTTWNNYIVCSYNPPGNYLGE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 31/156 (20%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 32/162 (20%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344577
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.