DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and AT1G50050

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_175427.1 Gene:AT1G50050 / 841429 AraportID:AT1G50050 Length:226 Species:Arabidopsis thaliana


Alignment Length:157 Identity:35/157 - (22%)
Similarity:53/157 - (33%) Gaps:54/157 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 AGQNNALFQYSGAETEYTDAEIIKEQIENWFAER------SNASPEILASFPEELPNKAVTKFTI 179
            |..|||||....|             :..|..|:      :||.          :..:....:|.
plant    82 ANGNNALFTGVAA-------------VNLWVNEKPYYNYTANAC----------IGAQQCKHYTQ 123

  Fly   180 AVAEKNTHVGCAAVRFSRDFYNHFVLTCNFATS------NIVGQPVYTPGEKATTGC---KNRYG 235
            .|...:..:|||.|..:...|  || .||:..|      .|......|.|..|:..|   :|::.
plant   124 VVWSNSVKIGCARVLCNNGGY--FV-GCNYDASAALKSRKITASVRQTRGLGASAACGQLRNKFQ 185

  Fly   236 AAYDYPNLCYAK----------EIYDN 252
            .:   |:|..|:          |.:||
plant   186 KS---PSLATAEGEVIEARLRSEDFDN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 22/94 (23%)
AT1G50050NP_175427.1 SCP 27..151 CDD:294090 22/94 (23%)
Radical_SAM <155..185 CDD:302752 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.