DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and AT1G01310

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_171638.2 Gene:AT1G01310 / 839333 AraportID:AT1G01310 Length:241 Species:Arabidopsis thaliana


Alignment Length:144 Identity:32/144 - (22%)
Similarity:49/144 - (34%) Gaps:44/144 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 FQYSGAETEYT---------DAEIIKEQ---IENWF-AERSNASP-EILASFPEE---------- 168
            ||:.|....|.         |..::...   .||.| |.::|.|| :|:..:.:|          
plant   104 FQWDGRLAAYARTWANQRVGDCRLVHSNGPYGENIFWAGKNNWSPRDIVNVWADEDKFYDVKGNT 168

  Fly   169 -LPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVLTCNFATSNIVGQPVYTP-----GEKAT 227
             .|......:|..|...:|.||||:|              :.:...:....||.|     ||...
plant   169 CEPQHMCGHYTQIVWRDSTKVGCASV--------------DCSNGGVYAICVYNPPGNYEGENPF 219

  Fly   228 TGCKNRYGAAYDYP 241
            ....::.|.|.|.|
plant   220 GSYDDQIGLARDDP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 23/106 (22%)
AT1G01310NP_171638.2 SCP_PR-1_like 87..219 CDD:240181 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.