DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and AT5G66590

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_201460.1 Gene:AT5G66590 / 836791 AraportID:AT5G66590 Length:185 Species:Arabidopsis thaliana


Alignment Length:240 Identity:48/240 - (20%)
Similarity:74/240 - (30%) Gaps:75/240 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAIKCLILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKL--ILNL 63
            ||:...|:..:||.||:.|   ..|....|              ||.:......|...:  ....
plant     1 MALTHHIIFVALLVISVKA---ISPAAKLK--------------PKQIVSTSPPPPPTISAAAKA 48

  Fly    64 FNELRNNVAGGKIEGLPKAVRMAKMSWCEEL----SHLALL--NVKTCESLPDKCRSTERFAYAG 122
            |.:..|....  :.|:|..|      |.:.|    |.||..  |.|.||             :|.
plant    49 FTDAHNKARA--MVGVPPLV------WSQTLEAAASRLARYQRNQKKCE-------------FAS 92

  Fly   123 QNNALFQYSGAETEYTDAEII---KEQIENWFAERS--NASPEILASFPEELPNKAVTKFTIAVA 182
            .|...:   ||...:....:.   ...:|.|..|:.  |...:..|:      |.....:...|.
plant    93 LNPGKY---GANQLWAKGLVAVTPSLAVETWVKEKPFYNYKSDTCAA------NHTCGVYKQVVW 148

  Fly   183 EKNTHVGCAAVRFSRD-------FYNHFVLTCNFATSNIVGQPVY 220
            ..:..:|||....:::       |||        ...|::||..|
plant   149 RNSKELGCAQATCTKESTVLTICFYN--------PPGNVIGQKPY 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 31/171 (18%)
AT5G66590NP_201460.1 CAP_PR-1 46..185 CDD:349400 34/176 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.