DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and AT4G25780

DIOPT Version :10

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_194308.1 Gene:AT4G25780 / 828683 AraportID:AT4G25780 Length:190 Species:Arabidopsis thaliana


Alignment Length:45 Identity:14/45 - (31%)
Similarity:19/45 - (42%) Gaps:4/45 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 FTIAVAEKNTHVGCAAVRFSRDFYNHFVLTCNF-ATSNIVGQPVY 220
            :|..|.:....||||.|....   ....:|||: ...|.:||..|
plant   149 YTQIVWKSTRRVGCARVVCDN---GGIFMTCNYDPPGNYIGQKPY 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 CAP_euk 57..210 CDD:349399 10/33 (30%)
AT4G25780NP_194308.1 CAP_PR-1 54..190 CDD:349400 13/43 (30%)

Return to query results.
Submit another query.