DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and AT3G19690

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:186 Identity:43/186 - (23%)
Similarity:63/186 - (33%) Gaps:52/186 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FSENCPKDVREVKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKT 104
            |..:..:|:::..:|.|        ||.||.|      ||...|      |.:|::..|   ...
plant    17 FYGSLAEDLQQQFLEAH--------NEARNEV------GLDPLV------WDDEVAAYA---ASY 58

  Fly   105 CESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEIIKEQIENWFAER------SNASPEILA 163
            .....:.|.........|:|.|:   |..|....||      .|.|..|:      ||...:   
plant    59 ANQRINDCALVHSNGPFGENIAM---SSGEMSAEDA------AEMWINEKQYYDYDSNTCND--- 111

  Fly   164 SFPEELPNKAVTKFTIAVAEKNT-HVGCAAVRFSRDFYNHFVLTCNF-ATSNIVGQ 217
                  ||.........|..||| .:|||.|..:.   ....:|||: ...|.:|:
plant   112 ------PNGGTCLHYTQVVWKNTVRLGCAKVVCNS---GGTFITCNYDPPGNYIGE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 37/159 (23%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 41/177 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.