DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and AT3G09590

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_187570.1 Gene:AT3G09590 / 820116 AraportID:AT3G09590 Length:186 Species:Arabidopsis thaliana


Alignment Length:212 Identity:42/212 - (19%)
Similarity:74/212 - (34%) Gaps:55/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CLILL-------TSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILN 62
            ||:||       .|:||.|       :|..::......|:          .|..|:.   :..|.
plant    11 CLLLLFLLFSGHPSVLGTS-------IPDAVNTAARLVNR----------ARRAKLS---REFLQ 55

  Fly    63 LFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAL 127
            ..|:.|.:      .|:|      .:.|..:|:..|   .|..:.....|.........|:|  :
plant    56 AHNDARVS------SGVP------TLGWDRDLARFA---DKWAKQRKSDCSMIHSGGPYGEN--I 103

  Fly   128 FQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAA 192
            |.:...:| ::..::    :..||.||.|...:....    .|.|....:|..|..:.|.||||.
plant   104 FWHRRKKT-WSPEKV----VTRWFEERFNYDVKTNTC----APGKMCGHYTQMVWRETTAVGCAR 159

  Fly   193 VRFSRDFYNHFVLTCNF 209
            |:....  ..:::.|.:
plant   160 VKCHNG--RGYLVVCEY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 30/152 (20%)
AT3G09590NP_187570.1 CAP_PR-1 50..186 CDD:349400 30/156 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.