DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and PR1

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_179068.1 Gene:PR1 / 815949 AraportID:AT2G14610 Length:161 Species:Arabidopsis thaliana


Alignment Length:181 Identity:36/181 - (19%)
Similarity:63/181 - (34%) Gaps:46/181 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SENCPKDVREVKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC 105
            :::.|:|            .|.:.|:.|.            ||.:..|.|.|.::..|.   ...
plant    26 AQDSPQD------------YLRVHNQARG------------AVGVGPMQWDERVAAYAR---SYA 63

  Fly   106 ESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELP 170
            |.|...||........|:|.|   :...:.....|      :..|.:|::|      .::.....
plant    64 EQLRGNCRLIHSGGPYGENLA---WGSGDLSGVSA------VNMWVSEKAN------YNYAANTC 113

  Fly   171 NKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVLTCNF-ATSNIVGQPVY 220
            |.....:|..|..|:..:|||.||.:.   ...:::||: ...|.|.:..|
plant   114 NGVCGHYTQVVWRKSVRLGCAKVRCNN---GGTIISCNYDPRGNYVNEKPY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 31/152 (20%)
PR1NP_179068.1 SCP_PR-1_like 30..161 CDD:240181 35/175 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.