DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and PRB1

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:218 Identity:43/218 - (19%)
Similarity:70/218 - (32%) Gaps:65/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KCLILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELR 68
            :.||:|.:|:|        ||                       |..:|.:...:..:|..|:.|
plant     8 RILIILAALVG--------AL-----------------------VVPLKAQDSQQDYVNAHNQAR 41

  Fly    69 NNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQYSGA 133
            :.:..|            .|.|.|.|:..|.   .....|...||........|:|.|   .||.
plant    42 SQIGVG------------PMQWDEGLAAYAR---NYANQLKGDCRLVHSRGPYGENLA---KSGG 88

  Fly   134 ETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRD 198
            :.....|      :..|..|::|      .::.....|.....:|..|...:..:|||.||.:. 
plant    89 DLSGVAA------VNLWVNEKAN------YNYDTNTCNGVCGHYTQVVWRNSVRLGCAKVRCNN- 140

  Fly   199 FYNHFVLTCNF-ATSNIVGQPVY 220
              ...:::||: ...|...|..|
plant   141 --GGTIISCNYDPPGNYANQKPY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 31/152 (20%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 33/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.