DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and Crisp4

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:254 Identity:54/254 - (21%)
Similarity:90/254 - (35%) Gaps:61/254 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAIKCLILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFN 65
            ||:|.::||.....:.:..   ..|..||:  |..|         |.:.|.:.||..: |:|..|
Mouse    44 MAVKFILLLFVAAFVPVVT---IRPLKLDR--ALYN---------KLITESQTEPQEE-IVNTHN 93

  Fly    66 ELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC-----ESLPDKCRSTERFAYAGQNN 125
            ..|..|:       |.|..|.|:||....:..|.:..:.|     :||..:..:|    :.|:|.
Mouse    94 AFRRKVS-------PPARNMLKVSWSSAAAENARILARYCDKSDSDSLERRLPNT----FCGENM 147

  Fly   126 ALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTH-VG 189
            .:..|..:.::.         ||.||.|..........|..:::.....|:...|    :|: ||
Mouse   148 LMEHYPSSWSKV---------IEIWFNESKYFKYGEWPSTDDDIETDHYTQMVWA----STYLVG 199

  Fly   190 CAAVRFSRDFYNHFVLTCNFA----TSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLC 244
            |......|.....::..|::.    ..:.:..| |..|....           |.||.|
Mouse   200 CDVAACRRQKAATYLYVCHYCHEGNHQDTLNMP-YKEGSPCD-----------DCPNNC 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 33/157 (21%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841336
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.