DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-B and Glipr1

DIOPT Version :9

Sequence 1:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006514280.1 Gene:Glipr1 / 73690 MGIID:1920940 Length:270 Species:Mus musculus


Alignment Length:208 Identity:43/208 - (20%)
Similarity:64/208 - (30%) Gaps:71/208 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EVKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPD---K 111
            ::..|...|..:.:.|:||:.|:       |.|..|..|||..:|:.:|....|:||...:   .
Mouse    27 DITNEDFIKECVQVHNQLRSKVS-------PPARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLH 84

  Fly   112 CRSTERFAYAGQN-----NALFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPN 171
            .|....|...|:|     .::|..|.|             |..|:.|..:      ..|......
Mouse    85 SRIHPNFTALGENIWLGSLSIFSVSSA-------------ISAWYEEIKH------YDFSTRKCR 130

  Fly   172 KAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVLTC----NFATSNIVGQPVYTPGEKATTGCKN 232
            .....:|..|...:..:|||            |..|    ||...                    
Mouse   131 HVCGHYTQVVWADSYKLGCA------------VQLCPNGANFICD-------------------- 163

  Fly   233 RYGAAYDYPNLCY 245
             ||.|.:||...|
Mouse   164 -YGPAGNYPTWPY 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 35/163 (21%)
Glipr1XP_006514280.1 CAP_GLIPR1-like 32..168 CDD:349404 38/194 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.